
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LINGO4 Antibody
상품 한눈에 보기
Human LINGO4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 연구용에 적합. LRRN6D로도 알려진 LINGO4 단백질 검출에 사용. PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증된 반응성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060781-100 Anti-LINGO4 Antibody, leucine rich repeat and Ig domain containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060781-25 Anti-LINGO4 Antibody, leucine rich repeat and Ig domain containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LINGO4 Antibody
Anti-LINGO4 Antibody
leucine rich repeat and Ig domain containing 4 (LINGO4)
Alternative Gene Name: LRRN6D
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LINGO4 protein.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat and Ig domain containing 4 |
| Target Gene | LINGO4 |
| Alternative Gene Name | LRRN6D |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000044505 | 98% |
| Rat | ENSRNOG00000022863 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



