CacheBy
Atlas Antibodies Anti-LINGO4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LINGO4 Antibody

상품 한눈에 보기

Human LINGO4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 연구용에 적합. LRRN6D로도 알려진 LINGO4 단백질 검출에 사용. PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증된 반응성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060781-100 Anti-LINGO4 Antibody, leucine rich repeat and Ig domain containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060781-25 Anti-LINGO4 Antibody, leucine rich repeat and Ig domain containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LINGO4 Antibody

Anti-LINGO4 Antibody

leucine rich repeat and Ig domain containing 4 (LINGO4)
Alternative Gene Name: LRRN6D


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human LINGO4 protein.


Target Information

항목 내용
Target Protein leucine rich repeat and Ig domain containing 4
Target Gene LINGO4
Alternative Gene Name LRRN6D
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVP

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000044505 98%
Rat ENSRNOG00000022863 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.