CacheBy
Atlas Antibodies Anti-LIN9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIN9 Antibody

상품 한눈에 보기

인간 LIN9 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 사람에 대한 반응성이 검증되었고, 쥐와 생쥐에서도 높은 상동성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030241-100 Anti-LIN9 Antibody, lin-9 DREAM MuvB core complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030241-25 Anti-LIN9 Antibody, lin-9 DREAM MuvB core complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIN9 Antibody

Anti-LIN9 Antibody

Target: lin-9 DREAM MuvB core complex component
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LIN9.

Alternative Gene Names

  • TGS

Open Datasheet

Target Information

항목 내용
Target Protein lin-9 DREAM MuvB core complex component
Target Gene LIN9
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000023304 (96%), Mouse ENSMUSG00000058729 (96%)

Antigen Information

항목 내용
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.