Atlas Antibodies Anti-LIMA1 Antibody

상품 한눈에 보기

Human LIMA1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 정교한 Orthogonal Validation 제공. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 다양한 조직 및 세포 라인에서 단백질 발현 검증에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052645-100 Anti-LIMA1 Antibody, LIM domain and actin binding 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052645-25 Anti-LIMA1 Antibody, LIM domain and actin binding 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

LIM domain and actin binding 1

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human LIMA1

EPLIN

항목	내용
Target Protein	LIM domain and actin binding 1
Target Gene	LIMA1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000059801 (74%), Mouse ENSMUSG00000023022 (74%)

Antigen Sequence:
ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand