CacheBy
Atlas Antibodies Anti-LEMD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LEMD3 Antibody

상품 한눈에 보기

Human LEMD3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에서 검증되었으며 마우스·랫과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025078-100 Anti-LEMD3 Antibody, LEM domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025078-25 Anti-LEMD3 Antibody, LEM domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LEMD3 Antibody

Anti-LEMD3 Antibody

LEM domain containing 3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human LEMD3.


Alternative Gene Names

  • MAN1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein LEM domain containing 3
Target Gene LEMD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000048661 (96%), Rat ENSRNOG00000024027 (95%)

Antigen Sequence:
QGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRT


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.