
원본
Atlas Antibodies Anti-LDLRAD3 Antibody
상품 한눈에 보기
Human LDLRAD3 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB(재조합 발현), ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제. 인체 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038251-100 Anti-LDLRAD3 Antibody, low density lipoprotein receptor class A domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038251-25 Anti-LDLRAD3 Antibody, low density lipoprotein receptor class A domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LDLRAD3 Antibody
Anti-LDLRAD3 Antibody
Target: Low density lipoprotein receptor class A domain containing 3 (LDLRAD3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression validation using target protein overexpression)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human LDLRAD3.
Alternative Gene Names
- LRAD3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Low density lipoprotein receptor class A domain containing 3 |
| Target Gene | LDLRAD3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPA |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000048058 | 97% |
| Rat | ENSRNOG00000058157 | 97% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



