CacheBy
Atlas Antibodies Anti-LDLRAD3 Antibody
원본

Atlas Antibodies Anti-LDLRAD3 Antibody

상품 한눈에 보기

Human LDLRAD3 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB(재조합 발현), ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038251-100 Anti-LDLRAD3 Antibody, low density lipoprotein receptor class A domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038251-25 Anti-LDLRAD3 Antibody, low density lipoprotein receptor class A domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LDLRAD3 Antibody

Anti-LDLRAD3 Antibody

Target: Low density lipoprotein receptor class A domain containing 3 (LDLRAD3)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression validation using target protein overexpression)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human LDLRAD3.


Alternative Gene Names

  • LRAD3

Open Datasheet


Target Information

항목 내용
Target Protein Low density lipoprotein receptor class A domain containing 3
Target Gene LDLRAD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000048058 97%
Rat ENSRNOG00000058157 97%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.