CacheBy
Atlas Antibodies Anti-LCAT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCAT Antibody

상품 한눈에 보기

인간 LCAT 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며 재조합 발현 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤/PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044767-100 Anti-LCAT Antibody, lecithin-cholesterol acyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044767-25 Anti-LCAT Antibody, lecithin-cholesterol acyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCAT Antibody

Anti-LCAT Antibody

Target: lecithin-cholesterol acyltransferase (LCAT)
Supplier: Atlas Antibodies


  • WB (Western Blot): Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human LCAT (lecithin-cholesterol acyltransferase).

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein lecithin-cholesterol acyltransferase
Target Gene LCAT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019573 (89%), Mouse ENSMUSG00000035237 (88%)

Antigen Sequence:
VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF


Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.