CacheBy
Atlas Antibodies Anti-ADGRG5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRG5 Antibody

상품 한눈에 보기

인간 ADGRG5 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Rabbit 유래 IgG, PrEST 항원 기반 친화 정제.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA007133-100 Anti-ADGRG5 Antibody, adhesion G protein-coupled receptor G5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007133-25 Anti-ADGRG5 Antibody, adhesion G protein-coupled receptor G5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRG5 Antibody

Anti-ADGRG5 Antibody

Target: adhesion G protein-coupled receptor G5 (ADGRG5)
Type: Polyclonal Antibody against Human ADGRG5
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody targeting human ADGRG5, also known as adhesion G protein-coupled receptor G5.


Alternative Gene Names

  • GPR114
  • PGR27

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (PrEST):

ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000039891 61%
Mouse ENSMUSG00000061577 61%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Determine optimal concentrations and conditions experimentally.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.