CacheBy
Atlas Antibodies Anti-ADCYAP1R1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADCYAP1R1 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human ADCYAP1R1 (PAC1 receptor). Suitable for ICC applications. Affinity purified using PrEST antigen. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.

카탈로그번호
HPA049877-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049877-100 Anti-ADCYAP1R1 Antibody, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049877-25 Anti-ADCYAP1R1 Antibody, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADCYAP1R1 Antibody

Anti-ADCYAP1R1 Antibody

ADCYAP receptor type I

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ADCYAP1R1.

Alternative Gene Names

  • PAC1
  • PAC1R
  • PACAPR

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ADCYAP receptor type I
Target Gene ADCYAP1R1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012098 (89%), Mouse ENSMUSG00000029778 (87%)

Antigen Sequence:
KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.