Atlas Antibodies Anti-ADCY5 Antibody

상품 한눈에 보기

Human ADCY5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Adenylate cyclase 5 검출용으로 적합하며, 높은 특이성과 재현성을 제공합니다. Affinity purification 방식으로 정제되어 다양한 연구 응용에 사용 가능합니다.

카탈로그번호: HPA077682-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA077682-100 Anti-ADCY5 Antibody, adenylate cyclase 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA077682-25 Anti-ADCY5 Antibody, adenylate cyclase 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ADCY5 Antibody

Anti-ADCY5 Antibody

Target Information

Target Protein: Adenylate cyclase 5
Target Gene: ADCY5
Alternative Gene Names: AC5

Product Description

Polyclonal antibody against human ADCY5.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse: ENSMUSG00000022840 (79%)
Rat: ENSRNOG00000002229 (77%)

Recommended Applications

ICC (Immunocytochemistry)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand