CacheBy
Atlas Antibodies Anti-ADCY5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADCY5 Antibody

상품 한눈에 보기

Human ADCY5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Adenylate cyclase 5 검출용으로 적합하며, 높은 특이성과 재현성을 제공합니다. Affinity purification 방식으로 정제되어 다양한 연구 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA077682-100 Anti-ADCY5 Antibody, adenylate cyclase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077682-25 Anti-ADCY5 Antibody, adenylate cyclase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADCY5 Antibody

Anti-ADCY5 Antibody

Target Information

  • Target Protein: Adenylate cyclase 5
  • Target Gene: ADCY5
  • Alternative Gene Names: AC5

Product Description

Polyclonal antibody against human ADCY5.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000022840 (79%)
  • Rat: ENSRNOG00000002229 (77%)

ICC (Immunocytochemistry)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.