CacheBy
Atlas Antibodies Anti-ADAMTS9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADAMTS9 Antibody

상품 한눈에 보기

인간 ADAMTS9 단백질을 인식하는 토끼 다클론 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. ADAMTS9 관련 연구 및 단백질 발현 분석에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028601-100 Anti-ADAMTS9 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028601-25 Anti-ADAMTS9 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADAMTS9 Antibody

Anti-ADAMTS9 Antibody

Target: ADAM metallopeptidase with thrombospondin type 1 motif, 9
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ADAMTS9.


Alternative Gene Names

  • KIAA1312

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ADAM metallopeptidase with thrombospondin type 1 motif, 9
Target Gene ADAMTS9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000030022 (89%), Rat ENSRNOG00000023257 (83%)

Antigen Sequence:

VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.