CacheBy
Atlas Antibodies Anti-ADAMTS18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADAMTS18 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human ADAMTS18 protein. Affinity purified for high specificity and sensitivity. Suitable for immunohistochemistry and other research applications. Provided in PBS with glycerol and sodium azide preservative.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044326-100 Anti-ADAMTS18 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044326-25 Anti-ADAMTS18 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADAMTS18 Antibody

Anti-ADAMTS18 Antibody

Target: ADAM metallopeptidase with thrombospondin type 1 motif, 18
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

OCR 텍스트: Recommended for IHC applications.


Product Description

Polyclonal antibody against human ADAMTS18.

Alternative Gene Names

  • ADAMTS21

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ADAM metallopeptidase with thrombospondin type 1 motif, 18
Target Gene ADAMTS18
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST

Species Reactivity

Species Identity
Human Verified
Rat (ENSRNOG00000050326) 84%
Mouse (ENSMUSG00000053399) 84%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.