
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADAMTS18 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human ADAMTS18 protein. Affinity purified for high specificity and sensitivity. Suitable for immunohistochemistry and other research applications. Provided in PBS with glycerol and sodium azide preservative.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA044326-100 Anti-ADAMTS18 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044326-25 Anti-ADAMTS18 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADAMTS18 Antibody
Anti-ADAMTS18 Antibody
Target: ADAM metallopeptidase with thrombospondin type 1 motif, 18
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
OCR 텍스트: Recommended for IHC applications.
Product Description
Polyclonal antibody against human ADAMTS18.
Alternative Gene Names
- ADAMTS21
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADAM metallopeptidase with thrombospondin type 1 motif, 18 |
| Target Gene | ADAMTS18 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST |
Species Reactivity
| Species | Identity |
|---|---|
| Human | Verified |
| Rat (ENSRNOG00000050326) | 84% |
| Mouse (ENSMUSG00000053399) | 84% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



