Atlas Antibodies Anti-ADAMTS16 Antibody

상품 한눈에 보기

인간 ADAMTS16 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. WB 및 ICC 응용에 적합하며, PrEST 항원으로 정제되었습니다. 인간에서 검증된 반응성을 가지며, 고순도 및 안정한 보존 용액을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA067668-100 Anti-ADAMTS16 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif 16 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA067668-25 Anti-ADAMTS16 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif 16 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal Antibody against Human ADAMTS16
ADAM metallopeptidase with thrombospondin type 1 motif 16

ADAMTS16s

항목	내용
Target Protein	ADAM metallopeptidase with thrombospondin type 1 motif 16
Target Gene	ADAMTS16
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000049538 (63%), Rat ENSRNOG00000016812 (61%)

Antigen Sequence:
GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand