CacheBy
Atlas Antibodies Anti-ADAM15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADAM15 Antibody

상품 한눈에 보기

인간 ADAM15 단백질을 인식하는 폴리클로나 항체로, IHC 및 Western Blot에 추천됩니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 반응하며 Rat 및 Mouse와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011633-100 Anti-ADAM15 Antibody, ADAM metallopeptidase domain 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011633-25 Anti-ADAM15 Antibody, ADAM metallopeptidase domain 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADAM15 Antibody

Anti-ADAM15 Antibody

Target Information

  • Target Protein: ADAM metallopeptidase domain 15
  • Target Gene: ADAM15
  • Alternative Gene Names: MDC15
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ADAM15.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    CQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity (%)
Rat ENSRNOG00000020590 84%
Mouse ENSMUSG00000028041 82%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.