CacheBy
Atlas Antibodies Anti-ACVR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACVR1 Antibody

상품 한눈에 보기

Human ACVR1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증되었으며 Mouse 및 Rat과 높은 상동성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046514-100 Anti-ACVR1 Antibody, activin A receptor type 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046514-25 Anti-ACVR1 Antibody, activin A receptor type 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACVR1 Antibody

Anti-ACVR1 Antibody

Target: activin A receptor, type I
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human ACVR1 protein.


Alternative Gene Names

ACVR1A, ACVRLK2, ALK2, SKR1

Open Datasheet (PDF)


Target Information

  • Target Protein: activin A receptor, type I
  • Target Gene: ACVR1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000026836 (98%)
  • Rat ENSRNOG00000005033 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.