Atlas Antibodies Anti-ACSL3 Antibody

상품 한눈에 보기

Human ACSL3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원을 이용해 Affinity 정제되었으며, 고순도와 높은 특이성을 제공합니다.

카탈로그번호: HPA071021-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071021-100 Anti-ACSL3 Antibody, acyl-CoA synthetase long-chain family member 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071021-25 Anti-ACSL3 Antibody, acyl-CoA synthetase long-chain family member 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACSL3 Antibody

Anti-ACSL3 Antibody

acyl-CoA synthetase long-chain family member 3

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human ACSL3

Alternative Gene Names

ACS3, FACL3, PRO2194

Open Datasheet

Target Information

항목	내용
Target Protein	acyl-CoA synthetase long-chain family member 3
Target Gene	ACSL3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000032883 (91%), Rat ENSRNOG00000014718 (90%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)