CacheBy
Atlas Antibodies Anti-ACOT13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACOT13 Antibody

상품 한눈에 보기

Human ACOT13 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat 종에 반응성을 검증받았습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA019881-100 Anti-ACOT13 Antibody, acyl-CoA thioesterase 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019881-25 Anti-ACOT13 Antibody, acyl-CoA thioesterase 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACOT13 Antibody

Anti-ACOT13 Antibody

Target Protein: acyl-CoA thioesterase 13
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ACOT13.

Alternative Gene Names

HT012, THEM2

Open Datasheet (PDF)

Target Information

  • Target Protein: acyl-CoA thioesterase 13
  • Target Gene: ACOT13
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000006717 92%
Rat ENSRNOG00000018415 90%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.