CacheBy
Atlas Antibodies Anti-ACD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACD Antibody

상품 한눈에 보기

Human ACD 단백질을 타겟으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Immunocytochemistry 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human 종에 대해 검증된 반응성을 보유.

카탈로그번호
HPA049411-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049411-100 Anti-ACD Antibody, adrenocortical dysplasia homolog (mouse) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049411-25 Anti-ACD Antibody, adrenocortical dysplasia homolog (mouse) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACD Antibody

Anti-ACD Antibody

Target Information

  • Target Protein: adrenocortical dysplasia homolog (mouse)
  • Target Gene: ACD
  • Alternative Gene Names: Pip1, Ptop, Tint1, Tpp1

면역세포화학 (ICC) 등 다양한 생명과학 연구 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human ACD

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000038973 48%
Mouse ENSMUSG00000038000 37%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.