
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ACD Antibody
상품 한눈에 보기
Human ACD 단백질을 타겟으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Immunocytochemistry 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human 종에 대해 검증된 반응성을 보유.
- 카탈로그번호
- HPA049411-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049411-100 Anti-ACD Antibody, adrenocortical dysplasia homolog (mouse) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049411-25 Anti-ACD Antibody, adrenocortical dysplasia homolog (mouse) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ACD Antibody
Anti-ACD Antibody
Target Information
- Target Protein: adrenocortical dysplasia homolog (mouse)
- Target Gene: ACD
- Alternative Gene Names: Pip1, Ptop, Tint1, Tpp1
Recommended Applications
면역세포화학 (ICC) 등 다양한 생명과학 연구 응용에 적합합니다.
Product Description
Polyclonal Antibody against Human ACD
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000038973 | 48% |
| Mouse | ENSMUSG00000038000 | 37% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



