CacheBy
Atlas Antibodies Anti-ACD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACD Antibody

상품 한눈에 보기

Human ACD 단백질을 타겟으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Immunocytochemistry 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human 종에 대해 검증된 반응성을 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049411-100 Anti-ACD Antibody, adrenocortical dysplasia homolog (mouse) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049411-25 Anti-ACD Antibody, adrenocortical dysplasia homolog (mouse) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACD Antibody

Anti-ACD Antibody

Target Information

  • Target Protein: adrenocortical dysplasia homolog (mouse)
  • Target Gene: ACD
  • Alternative Gene Names: Pip1, Ptop, Tint1, Tpp1

면역세포화학 (ICC) 등 다양한 생명과학 연구 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human ACD

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000038973 48%
Mouse ENSMUSG00000038000 37%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.