CacheBy
Atlas Antibodies Anti-ACHE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACHE Antibody

상품 한눈에 보기

Human ACHE 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. Recombinant PrEST 항원을 사용해 친화 정제되었으며, 인체 반응성이 검증되었습니다. ICC 등 다양한 응용에 적합합니다.

카탈로그번호
HPA027098-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027098-100 Anti-ACHE Antibody, acetylcholinesterase (Yt blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027098-25 Anti-ACHE Antibody, acetylcholinesterase (Yt blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACHE Antibody

Anti-ACHE Antibody

Target Information

  • Target Protein: acetylcholinesterase (Yt blood group)
  • Target Gene: ACHE
  • Alternative Gene Names: YT

면역세포화학(ICC) 등 다양한 생명과학 연구 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human ACHE.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRE

Species Reactivity

  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000023328 (91%)
    • Rat ENSRNOG00000050841 (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
  • Material Safety Data Sheet

Reference

Open Datasheet (PDF)

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.