CacheBy
Atlas Antibodies Anti-ACAP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACAP3 Antibody

상품 한눈에 보기

Human ACAP3 단백질을 인식하는 Rabbit Polyclonal 항체로, ArfGAP with coiled-coil, ankyrin repeat 및 PH domains 3을 타깃으로 함. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058381-100 Anti-ACAP3 Antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058381-25 Anti-ACAP3 Antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACAP3 Antibody

Anti-ACAP3 Antibody

Target: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human ACAP3.

Alternative Gene Names

  • CENTB5
  • KIAA1716

Open Datasheet

Target Information

항목 내용
Target Protein ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
Target Gene ACAP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000022307 (90%), Mouse ENSMUSG00000029033 (90%)

Antigen Sequence:

VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.