CacheBy
Atlas Antibodies Anti-ACAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ACAP1 Antibody

상품 한눈에 보기

Human ACAP1 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 및 ICC 실험에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 인간 특이성과 신뢰성 있는 반응성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075570-100 Anti-ACAP1 Antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075570-25 Anti-ACAP1 Antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ACAP1 Antibody

Anti-ACAP1 Antibody

Target: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 (ACAP1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ACAP1.

Alternative Gene Names

  • CENTB1
  • KIAA0050

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
Target Gene ACAP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000001588 (90%), Rat ENSRNOG00000015674 (89%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.