
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ACAP1 Antibody
상품 한눈에 보기
Human ACAP1 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 및 ICC 실험에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 인간 특이성과 신뢰성 있는 반응성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075570-100 Anti-ACAP1 Antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075570-25 Anti-ACAP1 Antibody, ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ACAP1 Antibody
Anti-ACAP1 Antibody
Target: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 (ACAP1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ACAP1.
Alternative Gene Names
- CENTB1
- KIAA0050
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 |
| Target Gene | ACAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000001588 (90%), Rat ENSRNOG00000015674 (89%) |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



