Atlas Antibodies Anti-ACACA Antibody

상품 한눈에 보기

Human ACACA 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 기반 Orthogonal 검증을 통해 단백질 발현이 확인되었습니다. Human 시료에 반응하며, ACC1/ACC로도 알려진 ACACA를 타깃합니다.

카탈로그번호: HPA036650-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036650-100 Anti-ACACA Antibody, acetyl-CoA carboxylase alpha 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036650-25 Anti-ACACA Antibody, acetyl-CoA carboxylase alpha 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ACACA Antibody

Anti-ACACA Antibody

acetyl-CoA carboxylase alpha

Recommended Applications

WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human ACACA

Alternative Gene Names

ACAC, ACC, ACC1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	acetyl-CoA carboxylase alpha
Target Gene	ACACA
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL