Atlas Antibodies Anti-ABTB1 Antibody

상품 한눈에 보기

인간 ABTB1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼 유래 IgG 형태이며, PrEST 항원을 이용해 친화정제되었습니다. 인간에서 검증되었으며 설치류와 높은 서열 유사성을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035023-100 Anti-ABTB1 Antibody, ankyrin repeat and BTB (POZ) domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035023-25 Anti-ABTB1 Antibody, ankyrin repeat and BTB (POZ) domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

ankyrin repeat and BTB (POZ) domain containing 1

Polyclonal antibody against human ABTB1 protein.

BPOZ, Btb3, BTBD21, EF1ABP

항목	내용
Target Protein	ankyrin repeat and BTB (POZ) domain containing 1
Target Gene	ABTB1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand