CacheBy
Atlas Antibodies Anti-ABR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABR Antibody

상품 한눈에 보기

Human ABR 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 및 PBS 완충액에 보존됨. Human에 반응성이 검증되었고, Mouse 및 Rat과 높은 상동성을 가짐.

카탈로그번호
HPA054824-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054824-100 Anti-ABR Antibody, active BCR-related 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054824-25 Anti-ABR Antibody, active BCR-related 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABR Antibody

Anti-ABR Antibody

Target: active BCR-related
Type: Polyclonal Antibody against Human ABR


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human ABR protein.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • MDB

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein active BCR-related
Target Gene ABR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000017631 (91%), Rat ENSRNOG00000056837 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.