CacheBy
Atlas Antibodies Anti-ABI3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABI3 Antibody

상품 한눈에 보기

Human ABI3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 분석에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Affinity purification 방식으로 높은 특이도와 재현성 제공. Human에 반응하며 Rat, Mouse와 유사성 높음.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017345-100 Anti-ABI3 Antibody, ABI family, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017345-25 Anti-ABI3 Antibody, ABI family, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABI3 Antibody

Anti-ABI3 Antibody

Target: ABI family, member 3 (ABI3)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human ABI3


Alternative Gene Names

NESH, SSH3BP3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ABI family, member 3
Target Gene ABI3
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000005575 (89%), Mouse ENSMUSG00000018381 (88%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence AYQVGNLAGHTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.