CacheBy
Atlas Antibodies Anti-ABHD6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABHD6 Antibody

상품 한눈에 보기

Human ABHD6 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식이며 PrEST 항원으로 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종간 반응성(인간·쥐·생쥐) 확인됨. PBS와 글리세롤 기반 버퍼에 안정화되어 제공됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073225-100 Anti-ABHD6 Antibody, abhydrolase domain containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073225-25 Anti-ABHD6 Antibody, abhydrolase domain containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABHD6 Antibody

Anti-ABHD6 Antibody

Target Information

  • Target Protein: abhydrolase domain containing 6
  • Target Gene: ABHD6
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    GKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000008167 (87%)
    • Mouse ENSMUSG00000025277 (86%)

Product Description

Polyclonal antibody against Human ABHD6.

Open Datasheet (PDF)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

ICC (Immunocytochemistry)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Material Safety Data Sheet (MSDS)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.