Atlas Antibodies Anti-ABHD16A Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA058606-100 | - | Atlas Antibodies HPA058606-100 Anti-ABHD16A Antibody, abhydrolase domain containing 16A 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA058606-25 | - | Atlas Antibodies HPA058606-25 Anti-ABHD16A Antibody, abhydrolase domain containing 16A 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-ABHD16A Antibody
abhydrolase domain containing 16A
Recommended Applications
Product Description
Polyclonal Antibody against Human ABHD16A
Alternative Gene Names
BAT5, D6S82E, NG26
Target Protein
abhydrolase domain containing 16A
Target Gene
ABHD16A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000056637 (93%)
Mouse ENSMUSG00000007036 (91%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|