CacheBy
Atlas Antibodies Anti-ABCF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ABCF2 Antibody

상품 한눈에 보기

Human ABCF2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성을 보장하며, 인간, 마우스, 랫트에 반응. RNA-seq 및 독립 항체 비교로 검증된 신뢰성 높은 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021815-100 Anti-ABCF2 Antibody, ATP-binding cassette, sub-family F (GCN20), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021815-25 Anti-ABCF2 Antibody, ATP-binding cassette, sub-family F (GCN20), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ABCF2 Antibody

Anti-ABCF2 Antibody

ATP-binding cassette, sub-family F (GCN20), member 2


  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Independent Antibody Validation)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC

Product Description

Polyclonal antibody against human ABCF2.


Alternative Gene Names

ABC28, EST133090, HUSSY-18, M-ABC1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ATP-binding cassette, sub-family F (GCN20), member 2
Target Gene ABCF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS

Species Reactivity

Verified Species Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000010609 (97%)
Mouse ENSMUSG00000028953 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB Independent
Independent Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.