Atlas Antibodies Anti-ABCF2 Antibody
상품 한눈에 보기
Human ABCF2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성을 보장하며, 인간, 마우스, 랫트에 반응. RNA-seq 및 독립 항체 비교로 검증된 신뢰성 높은 제품.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ABCF2 Antibody
ATP-binding cassette, sub-family F (GCN20), member 2
Recommended Applications
- IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Independent Antibody Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC
Product Description
Polyclonal antibody against human ABCF2.
Alternative Gene Names
ABC28, EST133090, HUSSY-18, M-ABC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP-binding cassette, sub-family F (GCN20), member 2 |
| Target Gene | ABCF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS |
Species Reactivity
| Verified Species | Human, Mouse, Rat |
|---|---|
| Interspecies Identity | Rat ENSRNOG00000010609 (97%) Mouse ENSMUSG00000028953 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-ABCG1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ABCG1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ABCF2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ABCF3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-ABCF2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.