AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ABCF2 Antibody
상품 한눈에 보기
Human ABCF2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성을 보장하며, 인간, 마우스, 랫트에 반응. RNA-seq 및 독립 항체 비교로 검증된 신뢰성 높은 제품.
- 카탈로그번호
- HPA021815-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021815-100 Anti-ABCF2 Antibody, ATP-binding cassette, sub-family F (GCN20), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021815-25 Anti-ABCF2 Antibody, ATP-binding cassette, sub-family F (GCN20), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ABCF2 Antibody
Anti-ABCF2 Antibody
ATP-binding cassette, sub-family F (GCN20), member 2
Recommended Applications
- IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Independent Antibody Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC
Product Description
Polyclonal antibody against human ABCF2.
Alternative Gene Names
ABC28, EST133090, HUSSY-18, M-ABC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP-binding cassette, sub-family F (GCN20), member 2 |
| Target Gene | ABCF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS |
Species Reactivity
| Verified Species | Human, Mouse, Rat |
|---|---|
| Interspecies Identity | Rat ENSRNOG00000010609 (97%) Mouse ENSMUSG00000028953 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.