AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AASDHPPT Antibody
상품 한눈에 보기
인간 AASDHPPT 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며 사람과 생쥐에 반응합니다. 안정적인 PBS/glycerol 버퍼에 보존제로 sodium azide가 포함되어 있습니다.
- 카탈로그번호
- HPA026687-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026687-100 Anti-AASDHPPT Antibody, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026687-25 Anti-AASDHPPT Antibody, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AASDHPPT Antibody
Anti-AASDHPPT Antibody
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human AASDHPPT
Alternative Gene Names
AASD-PPT, CGI-80, LYS5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase |
| Target Gene | AASDHPPT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Homology | Rat ENSRNOG00000005795 (88%), Mouse ENSMUSG00000025894 (87%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.