Atlas Antibodies Anti-AAGAB Antibody

상품 한눈에 보기

Human AAGAB 단백질을 인식하는 토끼 폴리클로날 항체로, alpha- 및 gamma-adaptin 결합 단백질 검출에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화정제됨. 인체 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039371-100 Anti-AAGAB Antibody, alpha- and gamma-adaptin binding protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039371-25 Anti-AAGAB Antibody, alpha- and gamma-adaptin binding protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: alpha- and gamma-adaptin binding protein
Type: Polyclonal Antibody against Human AAGAB

Polyclonal antibody raised in rabbit against Human AAGAB (alpha- and gamma-adaptin binding protein).

항목	내용
Target Protein	alpha- and gamma-adaptin binding protein
Target Gene	AAGAB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000008424 (81%), Mouse ENSMUSG00000037257 (78%)

Antigen Sequence:

KAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAAD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)