CacheBy
Atlas Antibodies Anti-ZYG11A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZYG11A Antibody

상품 한눈에 보기

인간 ZYG11A 단백질을 인식하는 토끼 폴리클로날 항체. 세포주기 조절 관련 연구에 적합. PrEST 항원을 이용한 친화 정제 방식. IHC 등 다양한 응용에 사용 가능. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030378-100 Anti-ZYG11A Antibody, zyg-11 family member A, cell cycle regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030378-25 Anti-ZYG11A Antibody, zyg-11 family member A, cell cycle regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZYG11A Antibody

Anti-ZYG11A Antibody

Target: zyg-11 family member A, cell cycle regulator
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.


Product Description

Polyclonal Antibody against Human ZYG11A


Alternative Gene Names

ZYG11

Open Datasheet


Target Information

항목 내용
Target Protein zyg-11 family member A, cell cycle regulator
Target Gene ZYG11A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HADLPVPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQLTGLRILSVFNVCFHTEDLANVSQLPR
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000034645 (59%), Rat ENSRNOG00000010885 (56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.