AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-KTI12 Antibody
상품 한눈에 보기
Human KTI12 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. Affinity purification 방식으로 제조되었으며, ICC 등 다양한 응용에 추천됩니다. Human 반응성 검증 완료, 안정적 PBS/glycerol buffer 포뮬레이션 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031203-100 Anti-KTI12 Antibody, KTI12 chromatin associated homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031203-25 Anti-KTI12 Antibody, KTI12 chromatin associated homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KTI12 Antibody
Anti-KTI12 Antibody
Target Information
- Target Protein: KTI12 chromatin associated homolog
- Target Gene: KTI12
- Alternative Gene Names: MGC20419, SBBI81, TOT4
Product Description
Polyclonal antibody against Human KTI12.
Recommended Applications
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
DQVTSQVLAGLMEAQKSAVPGGLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLSQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000073775 | 87% |
| Rat | ENSRNOG00000029662 | 27% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) containing 40% glycerol |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.