CacheBy
Atlas Antibodies Anti-KRBOX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KRBOX1 Antibody

상품 한눈에 보기

Human KRBOX1 단백질을 타깃으로 하는 토끼 폴리클로날 항체. PrEST 항원을 이용해 친화 정제됨. 면역세포화학(ICC) 등 다양한 응용에 적합. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046901-100 Anti-KRBOX1 Antibody, KRAB box domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046901-25 Anti-KRBOX1 Antibody, KRAB box domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KRBOX1 Antibody

Anti-KRBOX1 Antibody

Target: KRAB box domain containing 1 (KRBOX1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human KRBOX1.

Open Datasheet


Target Information

항목 내용
Target Protein KRAB box domain containing 1
Target Gene KRBOX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000034387 (28%), Rat ENSRNOG00000002272 (25%)

Antigen Sequence:

YEAVAFVVPPTSKPALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDR

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.