
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-KLLN Antibody
상품 한눈에 보기
인간 KLLN 단백질을 인식하는 폴리클로날 항체로, p53 조절 DNA 복제 억제 단백질 연구에 적합합니다. 토끼 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되어 연구용으로 신뢰성 높습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074502-100 Anti-KLLN Antibody, killin, p53-regulated DNA replication inhibitor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074502-25 Anti-KLLN Antibody, killin, p53-regulated DNA replication inhibitor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KLLN Antibody
Anti-KLLN Antibody
Target Protein: killin, p53-regulated DNA replication inhibitor
Recommended Applications
면역세포화학(ICC) 등 다양한 생명과학 연구용
Product Description
Polyclonal Antibody against Human KLLN
Alternative Gene Names
- killin
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000019964 (29%)
- Mouse ENSMUSG00000015468 (27%)
Specifications
| 항목 | 내용 |
|---|---|
| Target Gene | KLLN |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



