CacheBy
Atlas Antibodies Anti-KLHL21 Antibody
원본

Atlas Antibodies Anti-KLHL21 Antibody

상품 한눈에 보기

휴먼 KLHL21 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. 40% 글리세롤/PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051364-100 Anti-KLHL21 Antibody, kelch-like family member 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051364-25 Anti-KLHL21 Antibody, kelch-like family member 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KLHL21 Antibody

Anti-KLHL21 Antibody

Target Information

  • Target Protein: kelch-like family member 21
  • Target Gene: KLHL21
  • Alternative Gene Names: KIAA0469

Product Description

Polyclonal antibody against Human KLHL21, produced in rabbit. Suitable for use in immunohistochemistry and other research applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    MNQVHVGGSLAVLGGKLYVSGGYDNTFELSDVVEAYDPETRAWSVVGRLPEPTFWHGSVSIFRQFMPQTFSGGRGFELD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000073700 (96%)
  • Rat ENSRNOG00000003334 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.