CacheBy
Atlas Antibodies Anti-KLF8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KLF8 Antibody

상품 한눈에 보기

인간 KLF8 단백질을 인식하는 토끼 유래 폴리클로날 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 높은 종 간 항원 서열 유사성을 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071740-100 Anti-KLF8 Antibody, Kruppel-like factor 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071740-25 Anti-KLF8 Antibody, Kruppel-like factor 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KLF8 Antibody

Anti-KLF8 Antibody

Target Information

  • Target Protein: Kruppel-like factor 8
  • Target Gene: KLF8
  • Alternative Gene Names: BKLF3, DXS741, ZNF741

Product Description

Polyclonal antibody against human KLF8.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000041649 (90%)
  • Rat ENSRNOG00000039057 (90%)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.