CacheBy
Atlas Antibodies Anti-KLC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KLC3 Antibody

상품 한눈에 보기

인간 KLC3 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산됨. IHC 등 다양한 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간에 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056508-100 Anti-KLC3 Antibody, kinesin light chain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056508-25 Anti-KLC3 Antibody, kinesin light chain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KLC3 Antibody

Anti-KLC3 Antibody

Target Information

  • Target Protein: kinesin light chain 3
  • Target Gene: KLC3
  • Alternative Gene Names: KLC2L, KLCt, KNS2B

Product Description

Polyclonal antibody against human KLC3.

  • IHC (Immunohistochemistry)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    GQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000040714 (91%)
  • Rat: ENSRNOG00000018101 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.