CacheBy
Atlas Antibodies Anti-KLC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KLC1 Antibody

상품 한눈에 보기

Human KLC1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB에 적합. PrEST 항원으로 특이적 정제됨. 인간에 대한 반응성 검증 완료. 높은 마우스 및 랫트 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052450-100 Anti-KLC1 Antibody, kinesin light chain 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052450-25 Anti-KLC1 Antibody, kinesin light chain 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KLC1 Antibody

Anti-KLC1 Antibody

Target Information

  • Target Protein: Kinesin light chain 1
  • Target Gene: KLC1
  • Alternative Gene Names: hKLC1B, hKLC1G, hKLC1J, hKLC1N, hKLC1P, hKLC1R, hKLC1S, KLC, KNS2, KNS2A

Product Description

Polyclonal antibody against human KLC1.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
STMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000021288 (97%)
  • Rat ENSRNOG00000011572 (96%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.