CacheBy
Atlas Antibodies Anti-KIF5A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KIF5A Antibody

상품 한눈에 보기

Human KIF5A 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 인간·마우스·랫트 반응성이 검증되었습니다. 안정한 PBS/glycerol 버퍼에 보존되어 연구용으로 최적화된 제품입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004469-100 Anti-KIF5A Antibody, kinesin family member 5A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004469-25 Anti-KIF5A Antibody, kinesin family member 5A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KIF5A Antibody

Anti-KIF5A Antibody

Target: kinesin family member 5A
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human KIF5A.


Alternative Gene Names

D12S1889, MY050, NKHC, SPG10

Open Datasheet


Target Information

  • Target Protein: kinesin family member 5A
  • Target Gene: KIF5A
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000074657 91%
Rat ENSRNOG00000005299 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.