
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-KIF26B Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human KIF26B. Affinity purified for high specificity. Suitable for IHC and other research applications. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028562-100 Anti-KIF26B Antibody, kinesin family member 26B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028562-25 Anti-KIF26B Antibody, kinesin family member 26B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KIF26B Antibody
Anti-KIF26B Antibody
Target: kinesin family member 26B (KIF26B)
Product Type: Polyclonal Antibody against Human KIF26B
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
- FLJ10157
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | kinesin family member 26B |
| Target Gene | KIF26B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GIGTSSPGSLGGSPGFGTGSPGSGSGGGSSPGSDRGVWCENCNARLVELKRQALRLLLP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000026494 | 98% |
| Rat | ENSRNOG00000028624 | 98% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



