
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-KHK Antibody
상품 한눈에 보기
Human KHK 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간·마우스·랫에서 반응성이 검증되었습니다. RNA-seq 데이터 기반의 정교한 orthogonal validation 수행.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA007040-100 Anti-KHK Antibody, ketohexokinase (fructokinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007040-25 Anti-KHK Antibody, ketohexokinase (fructokinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-KHK Antibody
Anti-KHK Antibody
Target: ketohexokinase (fructokinase)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
- Western Blot (WB)
Product Description
Polyclonal antibody against human KHK.
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ketohexokinase (fructokinase) |
| Target Gene | KHK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQV |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000029162 (91%), Rat ENSRNOG00000008047 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



