CacheBy
Atlas Antibodies Anti-ZSCAN31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZSCAN31 Antibody

상품 한눈에 보기

인간 ZSCAN31 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 특이적 정제됨. 높은 특이성과 재현성을 제공하며 인체 시료 분석에 유용.

카탈로그번호
HPA007124-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007124-100 Anti-ZSCAN31 Antibody, zinc finger and SCAN domain containing 31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007124-25 Anti-ZSCAN31 Antibody, zinc finger and SCAN domain containing 31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZSCAN31 Antibody

Anti-ZSCAN31 Antibody

Target: Zinc finger and SCAN domain containing 31 (ZSCAN31)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZSCAN31.


Alternative Gene Names

  • ZNF310P
  • ZNF323

Open Datasheet


Target Information

  • Protein: Zinc finger and SCAN domain containing 31
  • Gene: ZSCAN31
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000051469 35%
Rat ENSRNOG00000048101 31%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Material Safety Data Sheet


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.