CacheBy
Atlas Antibodies Anti-ZSCAN29 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZSCAN29 Antibody

상품 한눈에 보기

인체 ZSCAN29 단백질을 표적으로 하는 폴리클로날 항체로, IHC 독립 검증을 통해 단백질 발현을 확인할 수 있습니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 반응하며, 연구용으로 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007241-100 Anti-ZSCAN29 Antibody, zinc finger and SCAN domain containing 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007241-25 Anti-ZSCAN29 Antibody, zinc finger and SCAN domain containing 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZSCAN29 Antibody

Anti-ZSCAN29 Antibody

Target: Zinc finger and SCAN domain containing 29 (ZSCAN29)
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human ZSCAN29.

Alternative Gene Names

FLJ35867, Zfp690, ZNF690

Open Datasheet

Target Information

  • Target Protein: Zinc finger and SCAN domain containing 29
  • Target Gene: ZSCAN29
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000050619 67%
Rat ENSRNOG00000012419 58%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.