CacheBy
Atlas Antibodies Anti-KCNK7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KCNK7 Antibody

상품 한눈에 보기

Human KCNK7 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. 면역세포화학 등 다양한 연구 응용에 적합하며, 높은 특이성과 재현성을 제공. 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077577-100 Anti-KCNK7 Antibody, potassium channel, two pore domain subfamily K, member 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077577-25 Anti-KCNK7 Antibody, potassium channel, two pore domain subfamily K, member 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KCNK7 Antibody

Anti-KCNK7 Antibody

Target: potassium channel, two pore domain subfamily K, member 7 (KCNK7)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human KCNK7 protein.


Alternative Gene Names

  • K2p7.1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Potassium channel, two pore domain subfamily K, member 7
Target Gene KCNK7
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000024936 75%
Rat ENSRNOG00000020784 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.