CacheBy
Atlas Antibodies Anti-KCNAB3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KCNAB3 Antibody

상품 한눈에 보기

Human KCNAB3 단백질을 인식하는 Rabbit Polyclonal 항체로, 전압 개폐성 칼륨 채널의 조절 서브유닛 연구에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 추천됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077993-100 Anti-KCNAB3 Antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077993-25 Anti-KCNAB3 Antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KCNAB3 Antibody

Anti-KCNAB3 Antibody

Target: potassium channel, voltage gated subfamily A regulatory beta subunit 3


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human KCNAB3.


Alternative Gene Names

  • AKR6A9
  • KCNA3B

Open Datasheet


Target Information

구분 내용
Target Protein potassium channel, voltage gated subfamily A regulatory beta subunit 3
Target Gene KCNAB3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000018470 (84%), Rat ENSRNOG00000008480 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 요소 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.