CacheBy
Atlas Antibodies Anti-KBTBD6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KBTBD6 Antibody

상품 한눈에 보기

Human KBTBD6 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG입니다. IHC 등 연구용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, Mouse 및 Rat과 80% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046861-100 Anti-KBTBD6 Antibody, kelch repeat and BTB (POZ) domain containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046861-25 Anti-KBTBD6 Antibody, kelch repeat and BTB (POZ) domain containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KBTBD6 Antibody

Anti-KBTBD6 Antibody

Target: kelch repeat and BTB (POZ) domain containing 6
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 연구용으로 권장됩니다.


Product Description

Polyclonal Antibody against Human KBTBD6


Alternative Gene Names

  • DKFZp547E1912

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein kelch repeat and BTB (POZ) domain containing 6
Target Gene KBTBD6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000043881 80%
Rat ENSRNOG00000047604 80%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.