CacheBy
Atlas Antibodies Anti-KANK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-KANK3 Antibody

상품 한눈에 보기

Human KANK3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증을 통해 품질이 보증됩니다. Human에 대한 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051153-100 Anti-KANK3 Antibody, KN motif and ankyrin repeat domains 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051153-25 Anti-KANK3 Antibody, KN motif and ankyrin repeat domains 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-KANK3 Antibody

Anti-KANK3 Antibody

Target: KN motif and ankyrin repeat domains 3 (KANK3)
Type: Polyclonal Antibody against Human KANK3


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression validation using target protein overexpression)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human KANK3 protein.


Alternative Gene Names

ANKRD47, FLJ46061

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein KN motif and ankyrin repeat domains 3
Target Gene KANK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK

Species Reactivity

  • Verified: Human
  • Interspecies Identity:
    • Rat ENSRNOG00000007230 (51%)
    • Mouse ENSMUSG00000042099 (45%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.