CacheBy
Atlas Antibodies Anti-JUNB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-JUNB Antibody

상품 한눈에 보기

Human JUNB 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 정교한 오쏘고날 검증 수행. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 및 설치류 간 높은 서열 동일성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019149-100 Anti-JUNB Antibody, jun B proto-oncogene 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019149-25 Anti-JUNB Antibody, jun B proto-oncogene 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-JUNB Antibody

Anti-JUNB Antibody

Target Information

  • Target Protein: jun B proto-oncogene
  • Target Gene: JUNB
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDL

Product Description

Polyclonal Antibody against Human JUNB

Open Datasheet

  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry): Suitable for cellular localization studies.

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000042838 91%
Mouse ENSMUSG00000052837 91%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.