Atlas Antibodies Anti-JMY Antibody

상품 한눈에 보기

Human JMY 단백질을 인식하는 토끼 폴리클로날 항체로, p53 조절 단백질 연구에 적합. IHC 및 WB 응용에 권장되며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스·랫과 높은 상동성을 가짐.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043308-100 Anti-JMY Antibody, junction mediating and regulatory protein, p53 cofactor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043308-25 Anti-JMY Antibody, junction mediating and regulatory protein, p53 cofactor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Junction mediating and regulatory protein, p53 cofactor
Supplier: Atlas Antibodies

Polyclonal antibody against human JMY protein, a p53 cofactor involved in junction regulation.

항목	내용
Target Protein	Junction mediating and regulatory protein, p53 cofactor
Target Gene	JMY
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLF
Verified Species Reactivity	Human
Interspecies Identity	Mouse (91%), Rat (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen as affinity ligand