CacheBy
Atlas Antibodies Anti-JAM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-JAM2 Antibody

상품 한눈에 보기

Human JAM2 단백질을 인식하는 Rabbit Polyclonal 항체로, junctional adhesion molecule 2 연구용으로 적합합니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 사용 가능합니다. Human에 반응성을 검증하였습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077346-100 Anti-JAM2 Antibody, junctional adhesion molecule 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077346-25 Anti-JAM2 Antibody, junctional adhesion molecule 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-JAM2 Antibody

Anti-JAM2 Antibody

Target: Junctional adhesion molecule 2 (JAM2)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human JAM2.


Alternative Gene Names

C21orf43, CD322, JAM-B, JAMB, VE-JAM

Open Datasheet


Target Information

항목 내용
Target Protein Junctional adhesion molecule 2
Target Gene JAM2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GVCYAQRKGYFSKETSFQKSNSSSKATTMS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000053062) – 80%
  • Rat (ENSRNOG00000042848) – 80%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.