CacheBy
Atlas Antibodies Anti-IWS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IWS1 Antibody

상품 한눈에 보기

인간 IWS1 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산됨. IHC 등 다양한 연구용 응용에 적합. 높은 종간 항원 서열 동일성(인간-마우스 97%, 인간-랫 97%)을 보임. PrEST 항원으로 친화 정제된 고순도 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061866-100 Anti-IWS1 Antibody, IWS1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061866-25 Anti-IWS1 Antibody, IWS1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IWS1 Antibody

Anti-IWS1 Antibody

Target Information

  • Target Protein: IWS1 homolog (S. cerevisiae)
  • Target Gene: IWS1
  • Alternative Gene Names: DKFZp761G0123, FLJ10006, FLJ14655, FLJ32319

Open Datasheet

Product Description

Polyclonal antibody against human IWS1.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

IHC (Immunohistochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IFGESGDEEEEEFTGFNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000024384 (97%)
  • Rat ENSRNOG00000014630 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.